PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn176591
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 195aa    MW: 22347.4 Da    PI: 8.2425
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn176591genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.4e-324497255
     G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                prlrWtpeLH++Fv+av++LGG+ kAtPk+il++m+v+gL ++hvkSHLQ+YR+
  Achn176591 44 PRLRWTPELHQHFVDAVQHLGGKYKATPKRILQMMSVNGLQISHVKSHLQMYRT 97
                8****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.73940100IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-284198IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-244498IPR006447Myb domain, plants
SuperFamilySSF466896.09E-154497IPR009057Homeodomain-like
PfamPF002493.2E-94596IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MTPHDQCTVP SIDDDALQAH PLNSEMKKGE KSGSVRRYNK SQLPRLRWTP ELHQHFVDAV  60
QHLGGKYKAT PKRILQMMSV NGLQISHVKS HLQMYRTMKL DRKGKAIHLT NLPMFWVCSP  120
HKMMFSERRA CQHEGKEFQG QVPWRDSSEI TSTRENFCGY VFQDTIGGTL SEMSKEEDVE  180
SQNESCDLSP IFPQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010272285.11e-40PREDICTED: putative Myb family transcription factor At1g14600 isoform X2
TrEMBLA5C4429e-36A5C442_VITVI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94591325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.16e-29G2-like family protein